The Longest Single-word Domain Name...

XiileXiile Join Date: 2003-02-22 Member: 13818Members
in Off-Topic
<div class="IPBDescription">Uh, wow.</div> <a href='http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/' target='_blank'>http://www.llanfairpwllgwyngyllgogerychwyr...iogogogoch.com/</a>
Yes, I have <i>way</i> too much time on my hands, and thats how I found this. <!--emo&:p--><img src='http://www.unknownworlds.com/forums/html//emoticons/tounge.gif' border='0' style='vertical-align:middle' alt='tounge.gif' /><!--endemo-->
<!--QuoteBegin-http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/+--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin-->Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com is the longest single word (without hyphens) .com domain name in the world.  It was registered by Internetters on 21st October 1999.

This Welsh town actually exists and its name translates as "The church of St. Mary in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the red cave".
<!--QuoteEnd--></td></tr></table><div class='postcolor'><!--QuoteEEnd-->
Pretty funny, really.
Off Topic Disagree Agree Awesome

Comments

  • saint0zsaint0z Join Date: 2002-10-16 Member: 1505Members, Constellation
    now, my life is complete
    Off Topic Disagree Agree Awesome
  • baconflapsbaconflaps Join Date: 2004-02-09 Member: 26314Members
    When a word has four L's in a row, and gogogoch as part of it, I discount it as a word. I don't care if it's a foreign language, that's just excessive. I mean really. Do you think the founders named the town with such a long word because of immense foresight, knowing they will have founded such a ridicuously obscure award-winning place?
    Off Topic Disagree Agree Awesome
  • XythXyth Avatar Join Date: 2003-11-04 Member: 22312Members
    Whoever named this town is probably the same guy who made the letter "y" in german called "ipsalon". I'm sure of it.
    Off Topic Disagree Agree Awesome
  • MonkfishMonkfish Sonic-boom-inducing buttcheeks of terrifying speed&#33; Join Date: 2003-06-03 Member: 16972Members
    Welsh people are crazy <!--emo&:p--><img src='http://www.unknownworlds.com/forums/html//emoticons/tounge.gif' border='0' style='vertical-align:middle' alt='tounge.gif' /><!--endemo-->
    Off Topic Disagree Agree Awesome
  • BigMadSteveBigMadSteve Join Date: 2003-02-12 Member: 13472Members
    edited February 2004
    What a coincidence...I was looking up the longest word today. The longest is about 1,900 letters long but the best I could find is 1,352. And here it is. (yes,one word)

    (Hmm, the browser seems to be taking out the dashes, copy and paste it if you want to read it easier <!--emo&:D--><img src='http://www.unknownworlds.com/forums/html//emoticons/biggrin.gif' border='0' style='vertical-align:middle' alt='biggrin.gif' /><!--endemo--> (if you want to read it at all <!--emo&:D--><img src='http://www.unknownworlds.com/forums/html//emoticons/biggrin.gif' border='0' style='vertical-align:middle' alt='biggrin.gif' /><!--endemo-->))

    ACETYL?SERYL?TYROSYL?SERYL?ISO?LEUCYL?THREONYL?SERYL?PROLYL?SERYL?GLUTAMINYL?PHENYL?ALANYL?VALYL?PHENYL?ALANYL?LEUCYL?SERYL?SERYL?VALYL?TRYPTOPHYL?ALANYL?ASPARTYL?PROLYL?ISOLEUCYL?GLUTAMYL?LEUCYL?LEUCYL?ASPARAGINYL?VALYL?CYSTEINYL?THREONYL?SERYL?SERYL?LEUCYL?GLYCYL?ASPARAGINYL?GLUTAMINYL?PHENYL?ALANYL?GLUTAMINYL?THREONYL?GLUTAMINYL?GLUTAMINYL?ALANYL?ARGINYL?THREONYL?THREONYL?GLUTAMINYL?VALYL?GLUTAMINYL?GLUTAMINYL?PHENYL?ALANYL?SERYL?GLUTAMINYL?VALYL?TRYPTOPHYL?LYSYL?PROLYL?PHENYL?ALANYL?PROLYL?GLUTAMINYL?SERYL?THREONYL?VALYL?ARGINYL?PHENYL?ALANYL?PROLYL?GLYCYL?ASPARTYL?VALYL?TYROSYL?LYSYL?VALYL?TYROSYL?ARGINYL?TYROSYL?ASPARAGINYL?ALANYL?VALYL?LEUCYL?ASPARTYL?PROLYL?LEUCYL?ISOLEUCYL?THREONYL?ALANYL?LEUCYL?LEUCYL?GLYCYL?THREONYL?PHENYL?ALANYL?ASPARTYL?THREONYL?ARGINYL?ASPARAGINYL?ARGINYL?ISOLEUCYL?ISOLEUCYL?GLUTAMYL?VALYL?GLUTAMYL?ASPARAGINYL?GLUTAMINYL?GLUTAMINYL?SERYL?PROLYL?THREONYL?THREONYL?ALANYL?GLUTAMYL?THREONYL?LEUCYL?ASPARTYL?ALANYL?THREONYL?ARGINYL?ARGINYL?VALYL?ASPARTYL?ASPARTYL?ALANYL?THREONYL?VALYL?ALANYL?ISOLEUCYL?ARGINYL?SERYL?ALANYL?ASPARAGINYL?ISOLEUCYL?ASPARAGINYL?LEUCYL?VALYL?ASPARAGINYL?GLUTAMYL?LEUCYL?VALYL?ARGINYL?GLYCYL?THREONYL?GLYCYL?LEUCYL?TYROSYL?ASPARAGINYL?GLUTAMINYL?ASPARAGINYL?THREONYL?PHENYL?ALANYL?GLUTAMYL?SERYL?METHIONYL?SERYL?GLYCYL?LEUCYL?VALYL?TRYPTOPHYL?THREONYL?SERYL?ALANYL?PROLYL?ALANYL?SERINE

    It's the Tobacco Mosaic Virus, Dahlemense Strain.
    Off Topic Disagree Agree Awesome
  • MonkfishMonkfish Sonic-boom-inducing buttcheeks of terrifying speed&#33; Join Date: 2003-06-03 Member: 16972Members
    A welsh scientist probably made that up...
    Off Topic Disagree Agree Awesome
  • ZigZig ...I am Captain Planet&#33; Join Date: 2002-10-23 Member: 1576Members
    <!--QuoteBegin-baconflaps+Feb 10 2004, 03:48 PM--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (baconflaps @ Feb 10 2004, 03:48 PM)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin--> When a word has four L's in a row, and gogogoch as part of it, I discount it as a word. I don't care if it's a foreign language, that's just excessive. I mean really. Do you think the founders named the town with such a long word because of immense foresight, knowing they will have founded such a ridicuously obscure award-winning place? <!--QuoteEnd--> </td></tr></table><div class='postcolor'> <!--QuoteEEnd-->
    well, your name is baconflaps.. lol
    Off Topic Disagree Agree Awesome
  • LikuLiku I, am the Somberlain. Join Date: 2003-01-10 Member: 12128Members
    This is REAL stupid. I'm going to cry.
    Off Topic Disagree Agree Awesome
  • venomusvenomus Join Date: 2002-11-16 Member: 8951Members
    edited February 2004
    The name of that virus appears to be a string of amino acids written in long hand. So in theory you could type out a name like that for the entire human genome which would be however many billions of letters long...
    Off Topic Disagree Agree Awesome
  • MulletMullet Join Date: 2003-04-28 Member: 15910Members, Constellation
    <!--QuoteBegin-Kharaa_0z+Feb 10 2004, 04:46 PM--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (Kharaa_0z @ Feb 10 2004, 04:46 PM)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin--> now, my life is complete <!--QuoteEnd--> </td></tr></table><div class='postcolor'> <!--QuoteEEnd-->
    <!--emo&:0--><img src='http://www.unknownworlds.com/forums/html//emoticons/wow.gif' border='0' style='vertical-align:middle' alt='wow.gif' /><!--endemo--> You took the words right out of my mouth.
    Off Topic Disagree Agree Awesome
  • ElectricSheepElectricSheep Join Date: 2003-04-21 Member: 15716Members
    <!--QuoteBegin-venomus+Feb 10 2004, 07:55 PM--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (venomus @ Feb 10 2004, 07:55 PM)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin--> The name of that virus appears to be a string of amino acids written in long hand. So in theory you could type out a name like that for the entire human genome which would be however many billions of letters long... <!--QuoteEnd--> </td></tr></table><div class='postcolor'> <!--QuoteEEnd-->
    Adenine Guanine Thymine and Cytosine are the only known base pairs of any species on Eatrh so it could not be a string of DNA.
    Off Topic Disagree Agree Awesome
  • venomusvenomus Join Date: 2002-11-16 Member: 8951Members
    No, I just gave DNA as an example of complex molecule you could derive a longhand descriptive name for. Same goes for any chemical.
    Can't think of any, but there might be other scientific or specialist fields with derived naming systems. ALso, compound words can be made in certain languages like german IIRC.
    In any of these cases the longest possible word is only limited by your imagination/patience.
    Off Topic Disagree Agree Awesome
  • TychoCelchuuuTychoCelchuuu Anememone Join Date: 2002-03-23 Member: 345Members
    <!--QuoteBegin-Xyth+Feb 10 2004, 08:51 PM--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (Xyth @ Feb 10 2004, 08:51 PM)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin--> Whoever named this town is probably the same guy who made the letter "y" in german called "ipsalon". I'm sure of it. <!--QuoteEnd--> </td></tr></table><div class='postcolor'> <!--QuoteEEnd-->
    And in Spanish, it's igriega. Who makes up this stuff?
    Off Topic Disagree Agree Awesome
  • DOOManiacDOOManiac Worst. Critic. Ever. Join Date: 2002-04-17 Member: 462Members, NS1 Playtester
    meh, I still stand by The Fine Print (+1 old school points to all who get the reference). Antidisestablishmentarianism is the longest ROOT, non-medical word that isn't gibberish. So therefore, blah to your silly domain name silliness. All hail <a href='http://www.antidisestablishmentarianism.com' target='_blank'>antidisestablishmentarianism</a>!

    <!--QuoteBegin--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> </td></tr><tr><td id='QUOTE'><!--QuoteEBegin-->Antidisestablishmentarianism is a political philosophy that is opposed to the separation of church and state. The term originated in the context of the nineteenth century Church of England, where antidisestablismentarians were opposed to proposals to remove its status as the state church of England. The term has largely fallen into disuse, although the issue itself is still current. (See: Act of Settlement)

    "Antidisestablishmentarianism" is often quoted as one of the longest English words that has an actual meaning (as opposed to words that were made up for the purpose of being long — see Longest word in the English language), although there is a longer word that falls in the same category: "Pseudoantidisestablishmentarianism", meaning false opposition to the separation of the state and the church.<!--QuoteEnd--></td></tr></table><div class='postcolor'><!--QuoteEEnd-->
    (<a href='http://en.wikipedia.org/wiki/Antidisestablishmentarianism' target='_blank'>Source</a>)
    Off Topic Disagree Agree Awesome
  • RokiyoRokiyo A.K.A. .::FeX::. Revenge Join Date: 2002-10-10 Member: 1471Members, Constellation
    Anti-dis-establish-ment-arianism

    Are you sure it's a root? Sounds more like a root with 2 prefixes and 2 suffixes tacked on...
    Off Topic Disagree Agree Awesome
  • SoulSkorpionSoulSkorpion Join Date: 2002-04-12 Member: 423Members
    <!--QuoteBegin-XeroSlayer+Feb 11 2004, 07:42 AM--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (XeroSlayer @ Feb 11 2004, 07:42 AM)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin--> <a href='http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/' target='_blank'>http://www.llanfairpwllgwyngyllgogerychwyr...iogogogoch.com/</a>
    Yes, I have <i>way</i> too much time on my hands, and thats how I found this. <!--emo&:p--><img src='http://www.unknownworlds.com/forums/html//emoticons/tounge.gif' border='0' style='vertical-align:middle' alt='tounge.gif' /><!--endemo-->
    <!--QuoteBegin-http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/+--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin-->Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com is the longest single word (without hyphens) .com domain name in the world.? It was registered by Internetters on 21st October 1999.

    This Welsh town actually exists and its name translates as "The church of St. Mary in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the red cave".
    <!--QuoteEnd--></td></tr></table><div class='postcolor'><!--QuoteEEnd-->
    Pretty funny, really. <!--QuoteEnd--> </td></tr></table><div class='postcolor'> <!--QuoteEEnd-->
    Try saying <i>that</i> ten times, fast! <!--emo&;)--><img src='http://www.unknownworlds.com/forums/html//emoticons/wink.gif' border='0' style='vertical-align:middle' alt='wink.gif' /><!--endemo-->
    Off Topic Disagree Agree Awesome
  • JediYoshiJediYoshi The Cupcake Boss Join Date: 2002-05-27 Member: 674Members
    <!--QuoteBegin-BigMadSteve+Feb 10 2004, 04:57 PM--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (BigMadSteve @ Feb 10 2004, 04:57 PM)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin--> What a coincidence...I was looking up the longest word today. The longest is about 1,900 letters long but the best I could find is 1,352. <!--QuoteEnd--> </td></tr></table><div class='postcolor'> <!--QuoteEEnd-->
    There is no real longest word, ye fewl <!--emo&:p--><img src='http://www.unknownworlds.com/forums/html//emoticons/tounge.gif' border='0' style='vertical-align:middle' alt='tounge.gif' /><!--endemo-->

    You could just keep adding prefixes and other sci-esque terms and what not.
    Off Topic Disagree Agree Awesome
  • 2_of_Eight2_of_Eight Join Date: 2003-08-20 Member: 20016Members
    <!--QuoteBegin-SoulSkorpion+Feb 10 2004, 11:03 PM--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (SoulSkorpion @ Feb 10 2004, 11:03 PM)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin--> <!--QuoteBegin-XeroSlayer+Feb 11 2004, 07:42 AM--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (XeroSlayer @ Feb 11 2004, 07:42 AM)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin--> <a href='http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/' target='_blank'>http://www.llanfairpwllgwyngyllgogerychwyr...iogogogoch.com/</a>
    Yes, I have <i>way</i> too much time on my hands, and thats how I found this.  <!--emo&:p--><img src='http://www.unknownworlds.com/forums/html//emoticons/tounge.gif' border='0' style='vertical-align:middle' alt='tounge.gif' /><!--endemo-->
    <!--QuoteBegin-http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/+--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin-->Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com is the longest single word (without hyphens) .com domain name in the world.  It was registered by Internetters on 21st October 1999.

    This Welsh town actually exists and its name translates as "The church of St. Mary in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the red cave".
    <!--QuoteEnd--></td></tr></table><div class='postcolor'><!--QuoteEEnd-->
    Pretty funny, really. <!--QuoteEnd--></td></tr></table><div class='postcolor'><!--QuoteEEnd-->
    Try saying <i>that</i> ten times, fast! <!--emo&;)--><img src='http://www.unknownworlds.com/forums/html//emoticons/wink.gif' border='0' style='vertical-align:middle' alt='wink.gif' /><!--endemo--> <!--QuoteEnd--> </td></tr></table><div class='postcolor'> <!--QuoteEEnd-->
    Try saying it <i>once</i> <!--emo&:)--><img src='http://www.unknownworlds.com/forums/html//emoticons/smile.gif' border='0' style='vertical-align:middle' alt='smile.gif' /><!--endemo-->
    Jeez these people are stupid. They make some random word and add a few hundred prefixes/suffixes to that word.
    Chances are, these places don't exist. I won't believe anyone until I personally visit the place.
    Off Topic Disagree Agree Awesome
  • DOOManiacDOOManiac Worst. Critic. Ever. Join Date: 2002-04-17 Member: 462Members, NS1 Playtester
    <!--QuoteBegin-Revenge+Feb 10 2004, 08:59 PM--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (Revenge @ Feb 10 2004, 08:59 PM)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin--> Anti-dis-establish-ment-arianism

    Are you sure it's a root? Sounds more like a root with 2 prefixes and 2 suffixes tacked on... <!--QuoteEnd--> </td></tr></table><div class='postcolor'> <!--QuoteEEnd-->
    yup, its a root word. There is no "disestablishmentarianism" word. This has been debated many a times in The Fine Print. :)
    Off Topic Disagree Agree Awesome
  • CplDavisCplDavis I hunt the arctic Snonos Join Date: 2003-01-09 Member: 12097Members
    <!--QuoteBegin-baconflaps+Feb 10 2004, 06:48 PM--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (baconflaps @ Feb 10 2004, 06:48 PM)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin--> When a word has four L's in a row, and gogogoch as part of it, I discount it as a word. I don't care if it's a foreign language, that's just excessive. I mean really. Do you think the founders named the town with such a long word because of immense foresight, knowing they will have founded such a ridicuously obscure award-winning place? <!--QuoteEnd--> </td></tr></table><div class='postcolor'> <!--QuoteEEnd-->
    maybe they just did it to **** the future generations off lol..

    The are probably laughing in the after life.
    Off Topic Disagree Agree Awesome
  • HellbillyHellbilly A whole title out of pity... Join Date: 2002-11-02 Member: 3931Members, NS1 Playtester, Constellation
    I'd sure hate to live in a town called,

    Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
    nopparatrajathaniburiromudomrajaniwesmahasatharn
    amornphimarnavatarnsathitsakkattiyavisanukamprasit

    <!--emo&???--><img src='http://www.unknownworlds.com/forums/html//emoticons/confused.gif' border='0' style='vertical-align:middle' alt='confused.gif' /><!--endemo-->
    Off Topic Disagree Agree Awesome
  • BizZy_9mm_MessiahBizZy_9mm_Messiah Old School Member Join Date: 2003-07-25 Member: 18411Members, Constellation
    <!--QuoteBegin-venomus+Feb 10 2004, 07:55 PM--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (venomus @ Feb 10 2004, 07:55 PM)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin--> The name of that virus appears to be a string of amino acids written in long hand. So in theory you could type out a name like that for the entire human genome which would be however many billions of letters long... <!--QuoteEnd--> </td></tr></table><div class='postcolor'> <!--QuoteEEnd-->
    Someone or some groups of people may be doing it right now as we speak.
    Off Topic Disagree Agree Awesome
  • esunaesuna Rock Bottom Join Date: 2003-04-03 Member: 15175Members, Constellation
    edited February 2004
    <!--QuoteBegin-2_of_8+Feb 11 2004, 04:42 AM--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (2_of_8 @ Feb 11 2004, 04:42 AM)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin--> <!--QuoteBegin-SoulSkorpion+Feb 10 2004, 11:03 PM--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (SoulSkorpion @ Feb 10 2004, 11:03 PM)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin--> <!--QuoteBegin-XeroSlayer+Feb 11 2004, 07:42 AM--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (XeroSlayer @ Feb 11 2004, 07:42 AM)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin--> <a href='http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/' target='_blank'>http://www.llanfairpwllgwyngyllgogerychwyr...iogogogoch.com/</a>
    Yes, I have <i>way</i> too much time on my hands, and thats how I found this.  <!--emo&:p--><img src='http://www.unknownworlds.com/forums/html//emoticons/tounge.gif' border='0' style='vertical-align:middle' alt='tounge.gif' /><!--endemo-->
    <!--QuoteBegin-http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/+--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin-->Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com is the longest single word (without hyphens) .com domain name in the world.  It was registered by Internetters on 21st October 1999.

    This Welsh town actually exists and its name translates as "The church of St. Mary in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the red cave".
    <!--QuoteEnd--></td></tr></table><div class='postcolor'><!--QuoteEEnd-->
    Pretty funny, really. <!--QuoteEnd--></td></tr></table><div class='postcolor'><!--QuoteEEnd-->
    Try saying <i>that</i> ten times, fast! <!--emo&;)--><img src='http://www.unknownworlds.com/forums/html//emoticons/wink.gif' border='0' style='vertical-align:middle' alt='wink.gif' /><!--endemo--> <!--QuoteEnd--></td></tr></table><div class='postcolor'><!--QuoteEEnd-->
    Try saying it <i>once</i> <!--emo&:)--><img src='http://www.unknownworlds.com/forums/html//emoticons/smile.gif' border='0' style='vertical-align:middle' alt='smile.gif' /><!--endemo-->
    Jeez these people are stupid. They make some random word and add a few hundred prefixes/suffixes to that word.
    Chances are, these places don't exist. I won't believe anyone until I personally visit the place. <!--QuoteEnd--></td></tr></table><div class='postcolor'><!--QuoteEEnd-->
    I can assure you, this place does exist.

    Being from the UK myself, i've actually heard of this place before, so it's not really all that shocking or funny.

    Here's what <a href='http://www.nationmaster.com/encyclopedia/Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch' target='_blank'>nationmaster.com</a> has to say. Interesting piece of information on there, apparently llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch is the <b>third</b> longest place name in the world.


    *EDIT: Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu appears to be the longest.
    Off Topic Disagree Agree Awesome
  • ZeroByteZeroByte Join Date: 2002-11-01 Member: 3057Members
    <!--QuoteBegin-Nationmaster+--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (Nationmaster)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin--> A reasonable attempt at a pronunciation would be <i><b>Clan vire pulth gwinn gith gor gerrick win drob uth clan tay see lee oh go go gogch</b></i>. (The "gch" in the final syllable is the "glottal h" sound, similar to the sound used in the Yiddish "l'chaim". Saying gok glottally produces more or less the same effect.) Two lls can be pronounced either as 'cl' or 'l', or more precisely as an 'l', while passing air around the tongue (try blowing while saying "l").<!--QuoteEnd--></td></tr></table><div class='postcolor'><!--QuoteEEnd-->

    O_o how the crap do you pronounce that...
    Off Topic Disagree Agree Awesome
  • BogglesteinskyBogglesteinsky Join Date: 2002-12-24 Member: 11488Members
    <!--QuoteBegin-SoulSkorpion+Feb 11 2004, 04:03 AM--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (SoulSkorpion @ Feb 11 2004, 04:03 AM)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin--> Try saying <i>that</i> ten times, fast! <!--emo&;)--><img src='http://www.unknownworlds.com/forums/html//emoticons/wink.gif' border='0' style='vertical-align:middle' alt='wink.gif' /><!--endemo--> <!--QuoteEnd--> </td></tr></table><div class='postcolor'> <!--QuoteEEnd-->
    <i>that that that that that that that that that that </i>

    <!--emo&:p--><img src='http://www.unknownworlds.com/forums/html//emoticons/tounge.gif' border='0' style='vertical-align:middle' alt='tounge.gif' /><!--endemo-->

    The place in wales does exist
    Off Topic Disagree Agree Awesome
  • SoulSkorpionSoulSkorpion Join Date: 2002-04-12 Member: 423Members
    <!--QuoteBegin-Z.X. Bogglesteinsky+Feb 11 2004, 09:51 PM--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (Z.X. Bogglesteinsky @ Feb 11 2004, 09:51 PM)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin--> <!--QuoteBegin-SoulSkorpion+Feb 11 2004, 04:03 AM--></div><table border='0' align='center' width='95%' cellpadding='3' cellspacing='1'><tr><td><b>QUOTE</b> (SoulSkorpion @ Feb 11 2004, 04:03 AM)</td></tr><tr><td id='QUOTE'><!--QuoteEBegin--> Try saying <i>that</i> ten times, fast! <!--emo&;)--><img src='http://www.unknownworlds.com/forums/html//emoticons/wink.gif' border='0' style='vertical-align:middle' alt='wink.gif' /><!--endemo--> <!--QuoteEnd--></td></tr></table><div class='postcolor'><!--QuoteEEnd-->
    <i>that that that that that that that that that that </i>

    <!--emo&:p--><img src='http://www.unknownworlds.com/forums/html//emoticons/tounge.gif' border='0' style='vertical-align:middle' alt='tounge.gif' /><!--endemo--> <!--QuoteEnd--> </td></tr></table><div class='postcolor'> <!--QuoteEEnd-->
    *grin* I didn't see that one coming <!--emo&:)--><img src='http://www.unknownworlds.com/forums/html//emoticons/smile.gif' border='0' style='vertical-align:middle' alt='smile.gif' /><!--endemo-->
    Off Topic Disagree Agree Awesome
Sign In or Register to comment.